PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G526800.2.p
Common NameSb01g049020, SORBIDRAFT_01g049020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MIKC_MADS
Protein Properties Length: 234aa    MW: 26411.4 Da    PI: 9.3413
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G526800.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.32.3e-29959151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          krien + rqvtfskRrng+lKKA+ELSvLCdaeva+++fs++gkl+e++s
  Sobic.001G526800.2.p  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVVFSPRGKLFEFAS 59
                          79***********************************************86 PP

2K-box683.1e-2378171699
                 K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                           ++++ +++ e+ + +++ L k++e L   +R+llGe Le++s++eL++Le +Leksl  iR +K+ ll eq+++l++ke +l++ n++L
  Sobic.001G526800.2.p  78 SNKTVQQDIEQVKADAEGLAKKLEALDAYKRKLLGERLEECSIEELHSLEVKLEKSLHCIRGRKTLLLEEQVNKLKEKEMNLRKSNEDL 166
                           33467788999****************************************************************************** PP

                 K-box  95 rkkle 99 
                           r+k +
  Sobic.001G526800.2.p 167 REKCK 171
                           **976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.5E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.132161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.09E-32384IPR002100Transcription factor, MADS-box
CDDcd002651.23E-41378No hitNo description
PRINTSPR004041.1E-30323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.1E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-303859IPR002100Transcription factor, MADS-box
PfamPF014862.6E-2383171IPR002487Transcription factor, K-box
PROSITE profilePS5129713.07686176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000060Biological Processprotein import into nucleus, translocation
GO:0009409Biological Processresponse to cold
GO:0009739Biological Processresponse to gibberellin
GO:0009911Biological Processpositive regulation of flower development
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MVRGKTQMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALVVFSP RGKLFEFASG  60
SVQKTIERYR TYTKDNASNK TVQQDIEQVK ADAEGLAKKL EALDAYKRKL LGERLEECSI  120
EELHSLEVKL EKSLHCIRGR KTLLLEEQVN KLKEKEMNLR KSNEDLREKC KKQPPMLMAP  180
PPPPVPAVMT VEDDHPEPKD DGVDVETELY IGLPGRDYRS NKDKAAVAVS RSG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A2e-19372271Myocyte-specific enhancer factor 2A
3kov_B2e-19372271Myocyte-specific enhancer factor 2A
3kov_I2e-19372271Myocyte-specific enhancer factor 2A
3kov_J2e-19372271Myocyte-specific enhancer factor 2A
3p57_A2e-19372271Myocyte-specific enhancer factor 2A
3p57_B2e-19372271Myocyte-specific enhancer factor 2A
3p57_C2e-19372271Myocyte-specific enhancer factor 2A
3p57_D2e-19372271Myocyte-specific enhancer factor 2A
3p57_I2e-19372271Myocyte-specific enhancer factor 2A
3p57_J2e-19372271Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00076ChIP-chipTransfer from AT2G45660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4306420.0AJ430642.1 Zea mays mRNA for putative MADS-domain transcription factor (m5 gene).
GenBankBT0552160.0BT055216.1 Zea mays full-length cDNA clone ZM_BFc0137M15 mRNA, complete cds.
GenBankHQ8587750.0HQ858775.1 Zea mays clone UT1761 MADS transcription factor mRNA, partial cds.
GenBankKM1011250.0KM101125.1 Zea mays cultivar 18-599 SOC1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465961.11e-171hypothetical protein SORBIDRAFT_01g049020
SwissprotQ9XJ601e-117MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLC5X0V91e-171C5X0V9_SORBI; Putative uncharacterized protein Sb01g049020
STRINGSb01g049020.11e-170(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.12e-71AGAMOUS-like 20